PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco002326.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family SRS
Protein Properties Length: 304aa    MW: 32009.5 Da    PI: 8.5837
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco002326.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702222.77.3e-69732323154
       DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssaeskkel 100
                  s +++CqdCGnqakkdC+h+RCRtCCksrgfdC+thvkstWvpaa+rrerqq +aa +  a +sa+++a+k++r   s++++++s+t++s++++++++
  Aco002326.1  73 SSSSTCQDCGNQAKKDCTHRRCRTCCKSRGFDCSTHVKSTWVPAARRRERQQLTAA-NIGAGSSASTSAPKKPRLI-SSQTTTTSHTSTSNTTPPRSF 168
                  56789********************************************9776655.6788888999999999986.88899999************* PP

       DUF702 101 etss..........lPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                  +t+s          lP++v+++avf+cvrv+s++dge+++aYq+ v+igGhvfkG+LydqG+++
  Aco002326.1 169 DTTSshqdasfresLPRHVQAPAVFKCVRVTSIEDGEDQYAYQAMVTIGGHVFKGFLYDQGVDD 232
                  *9999********************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051424.6E-6375231IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016232.0E-2777119IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016242.6E-28183230IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0048364Biological Processroot development
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MNRFFSYHLF LSQLGLITLK PGTATSSIQF LQPQPQLPSR PVAAISYMRK PVPMFDAPGI  60
LSGAGVGLAG SSSSSSTCQD CGNQAKKDCT HRRCRTCCKS RGFDCSTHVK STWVPAARRR  120
ERQQLTAANI GAGSSASTSA PKKPRLISSQ TTTTSHTSTS NTTPPRSFDT TSSHQDASFR  180
ESLPRHVQAP AVFKCVRVTS IEDGEDQYAY QAMVTIGGHV FKGFLYDQGV DDGADHDHDH  240
DHDHAAATSN ASAIPNISEL HLGGGARNGA SSSSPMLPSD VYGGGPHGGG GFLGGTNFGN  300
PIN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009386850.11e-108PREDICTED: protein LATERAL ROOT PRIMORDIUM 1
SwissprotQ94CK92e-71LRP1_ARATH; Protein LATERAL ROOT PRIMORDIUM 1
TrEMBLM0U8V11e-108M0U8V1_MUSAM; Uncharacterized protein
STRINGGSMUA_AchrUn_randomP13420_0011e-107(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35793679
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12330.22e-60Lateral root primordium (LRP) protein-related